ALK-7, Human (Biotinylated, HEK293, His, Avi)
ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived ALK-7 protein, expressed by HEK293, with C-His & C-Avi tag.
Product Specifications
Product Name Alternative
ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi), Human, HEK293
UNSPSC
12352202
Smiles
LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
Molecular Formula
130399 (Gene_ID) Q8NER5 (L22-E113) (Accession)
Molecular Weight
Approximately 20-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-PKCa-Mu-48Tests 48 Tests
Mouse Protein Kinase C Alpha (PKCa) ELISA Kit
Sign In for Pricing
View Details 
bsm-62246R-BF647 100 µL
AKR1C1/2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
Sign In for Pricing
View Details