ALK-7, Human (Biotinylated, HEK293, His, Avi)

ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived ALK-7 protein, expressed by HEK293, with C-His & C-Avi tag.

ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi), Human, HEK293

12352202

LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME

130399 (Gene_ID) Q8NER5 (L22-E113) (Accession)

Approximately 20-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Dry ice.

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS8503911-01 0.1 mg

MBS8503911-02 0.1 mL (AF635)

MBS8503911-03 0.1 mL (AF610)

MBS8503911-04 0.1 mL (AF405S)

MBS8503911-05 0.1 mL (AF405L)

MBS8503911-06 0.1 mL (AF546)