Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP3, Human

FABP3 Protein, Human is the recombinant human-derived FABP3 protein, expressed by E. coli, with tag free tag.

Product Specifications

Product Name Alternative

FABP3 Protein, Human, Human, E. coli

UNSPSC

12352202

Smiles

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Molecular Formula

2170 (Gene_ID) P05413 (M1-A133) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CPT1C sgRNA gene knockout kit - Lentiviral human CPT1C sgRNA gene knockout kit (plasmid)
GTR15393419 1 Vial

Lentiviral human CPT1C sgRNA gene knockout kit - Lentiviral human CPT1C sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Anti-Human TP53/p53 Nanobody
MBS1567982-01 0.1 mg

Anti-Human TP53/p53 Nanobody

Sign In for Pricing
View Details
Anti-Human TP53/p53 Nanobody
MBS1567982-02 1 mg

Anti-Human TP53/p53 Nanobody

Sign In for Pricing
View Details
Anti-Human TP53/p53 Nanobody
MBS1567982-03 5x 1 mg

Anti-Human TP53/p53 Nanobody

Sign In for Pricing
View Details
3-Pyrrolidin-2-Ylmethylpyridine Dihydrochloride
232173-01 100 mg

3-Pyrrolidin-2-Ylmethylpyridine Dihydrochloride

Sign In for Pricing
View Details
3-Pyrrolidin-2-Ylmethylpyridine Dihydrochloride
232173-02 250 mg

3-Pyrrolidin-2-Ylmethylpyridine Dihydrochloride

Sign In for Pricing
View Details