Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79A, Cynomolgus (HEK293, His)

CD79A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD79 protein, expressed by HEK293, with C-His tag.

Product Specifications

Product Name Alternative

CD79A Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Smiles

LWVDGGPTSLMVSLGEEAHFQCLHNGSNANVTWWRVLHGNYTWPPQFVGKGQGYNGTLTIQNVNKSHGGIYLCRVQEGNKPHQQSCGTYLRVRHPPPRPFLDMGETKNR

Molecular Formula

102123895 (Gene_ID) XP_045235481.1 (L33-R142) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Phospho-POLR2A (Ser2) Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62939R-BF555-01 20 µL

Phospho-POLR2A (Ser2) Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Ask
View Details
Phospho-POLR2A (Ser2) Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62939R-BF555-02 100 µL

Phospho-POLR2A (Ser2) Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Ask
View Details
Metallothionein 1E (MT1E) Antibody (Biotin)
abx271488-01 200 µL

Metallothionein 1E (MT1E) Antibody (Biotin)

Ask
View Details
Metallothionein 1E (MT1E) Antibody (Biotin)
abx271488-02 1 mL

Metallothionein 1E (MT1E) Antibody (Biotin)

Ask
View Details
MARCH9, CT (MARCH9, RNF179, E3 ubiquitin-protein ligase MARCH9, Membrane-associated RING finger protein 9, Membrane-associated RING-CH protein IX, RING finger protein 179) (APC) discontinued
038198-APC 200 µL

MARCH9, CT (MARCH9, RNF179, E3 ubiquitin-protein ligase MARCH9, Membrane-associated RING finger protein 9, Membrane-associated RING-CH protein IX, RING finger protein 179) (APC) discontinued

Ask
View Details
SLC25A21 (NM_030631) Human Over-expression Lysate
LH12355V 100 µg

SLC25A21 (NM_030631) Human Over-expression Lysate

Ask
View Details