CD79A, Cynomolgus (HEK293, His)
CD79A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD79 protein, expressed by HEK293, with C-His tag.
Product Specifications
Product Name Alternative
CD79A Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293
UNSPSC
12352202
Smiles
LWVDGGPTSLMVSLGEEAHFQCLHNGSNANVTWWRVLHGNYTWPPQFVGKGQGYNGTLTIQNVNKSHGGIYLCRVQEGNKPHQQSCGTYLRVRHPPPRPFLDMGETKNR
Molecular Formula
102123895 (Gene_ID) XP_045235481.1 (L33-R142) (Accession)
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
