ALK-7, Cynomolgus (HEK293, His)
ALK-7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ALK-7 protein, expressed by HEK293, with C-His tag.
Product Specifications
Product Name Alternative
ALK-7 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293
UNSPSC
12352202
Purity
95.0
Smiles
GLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
Molecular Formula
102131774 (Gene_ID) A0A2K5VZP2 (G25-E113) (Accession)
Molecular Weight
Approximately 20-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881045-100 1x 100 µL
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402131-500 1x 500 µL
Mesothelin (Mesothelial Marker) (MSLN/2131), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942052-500 1x 500 µL
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041469-500 1x 500 µL
MCM7 (Proliferation Marker) (MCM7/1469), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details