FGF-1, Human (Biotinylated, His, Avi)
FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. FGF-1 Protein, Human (Biotinylated, His, Avi) is the recombinant human-derived FGF-1 protein, expressed by E. coli, with N-His and N-Avi labeled tag.
Product Specifications
Product Name Alternative
FGF-1 Protein, Human (Biotinylated, His, Avi), Human, E. coli
UNSPSC
12352202
Smiles
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular Formula
2246 (Gene_ID) P05230-1 (F16-D155) (Accession)
Molecular Weight
Approximately 20-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items