Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-1, Human (Biotinylated, His, Avi)

FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. FGF-1 Protein, Human (Biotinylated, His, Avi) is the recombinant human-derived FGF-1 protein, expressed by E. coli, with N-His and N-Avi labeled tag.

Product Specifications

Product Name Alternative

FGF-1 Protein, Human (Biotinylated, His, Avi), Human, E. coli

UNSPSC

12352202

Smiles

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Formula

2246 (Gene_ID) P05230-1 (F16-D155) (Accession)

Molecular Weight

Approximately 20-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Anthopleura asiatica Bandaporin
MBS1198967-01 0.02 mg (E-Coli)

Recombinant Anthopleura asiatica Bandaporin

Ask
View Details
Recombinant Anthopleura asiatica Bandaporin
MBS1198967-02 0.1 mg (E-Coli)

Recombinant Anthopleura asiatica Bandaporin

Ask
View Details
Recombinant Anthopleura asiatica Bandaporin
MBS1198967-03 0.02 mg (Yeast)

Recombinant Anthopleura asiatica Bandaporin

Ask
View Details
Recombinant Anthopleura asiatica Bandaporin
MBS1198967-04 0.1 mg (Yeast)

Recombinant Anthopleura asiatica Bandaporin

Ask
View Details
Recombinant Anthopleura asiatica Bandaporin
MBS1198967-05 0.02 mg (Baculovirus)

Recombinant Anthopleura asiatica Bandaporin

Ask
View Details
Recombinant Anthopleura asiatica Bandaporin
MBS1198967-06 0.02 mg (Mammalian-Cell)

Recombinant Anthopleura asiatica Bandaporin

Ask
View Details