PDE4A, Human (sf9, His)
PDE4A Protein, Human (sf9, His) is the recombinant human-derived PDE4A protein, expressed by Sf9 insect cells, with C-His tag.
Product Specifications
Product Name Alternative
PDE4A Protein, Human (sf9, His), Human, Sf9 insect cells
UNSPSC
12352202
Smiles
PMSQITGLKKLMHSNSLNNSNIPRFGVKTDQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEEISM
Molecular Formula
5414 (Gene_ID) P27815-1 (P333-M727) (Accession)
Molecular Weight
Approximately 45-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Rabbit Polyclonal Rab5b Antibody [Janelia Fluor 646]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
