Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MASP1, Mouse (HEK293, His)

MASP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MASP1 protein, expressed by HEK293, with C-His tag.

Product Specifications

Product Name Alternative

MASP1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Purity

95.00

Smiles

IGGRNAELGLFPWQALIVVEDTSRVPNDKWFGSGALLSESWILTAAHVLRSQRRDNTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVILHPDFNIQNYNHDIALVQLQKPVPLGAHVMPICLPRPEPEGPAPHMLGLVAGWGISNPNVTVDEIILSGTRTLSDVLQYVKLPVVSHAECKASYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDEMSQHWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWLWEEMNSPRAVRDLQVER

Molecular Formula

17174 (Gene_ID) P98064-2 (I455-R733) (Accession)

Molecular Weight

Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL 16 Human, (130 a.a.)
OM296718-01 10 µg

IL 16 Human, (130 a.a.)

Sign In for Pricing
View Details
IL 16 Human, (130 a.a.)
OM296718-02 2 µg

IL 16 Human, (130 a.a.)

Sign In for Pricing
View Details
IL 16 Human, (130 a.a.)
OM296718-03 1 mg

IL 16 Human, (130 a.a.)

Sign In for Pricing
View Details
N-Ethylbutylamine
TRC-E678405-50G 50 g

N-Ethylbutylamine

Sign In for Pricing
View Details
G protein alpha 16 (GNA15) Mouse Monoclonal Antibody [Clone ID: OTI1D3]
CF808159 100 µg

G protein alpha 16 (GNA15) Mouse Monoclonal Antibody [Clone ID: OTI1D3]

Sign In for Pricing
View Details
Allyl D-Glucuronate
TRC-A555400-500MG 500 mg

Allyl D-Glucuronate

Sign In for Pricing
View Details