Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MASP1, Mouse (HEK293, His)

MASP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MASP1 protein, expressed by HEK293, with C-His tag.

Product Specifications

Product Name Alternative

MASP1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Purity

95.00

Smiles

IGGRNAELGLFPWQALIVVEDTSRVPNDKWFGSGALLSESWILTAAHVLRSQRRDNTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVILHPDFNIQNYNHDIALVQLQKPVPLGAHVMPICLPRPEPEGPAPHMLGLVAGWGISNPNVTVDEIILSGTRTLSDVLQYVKLPVVSHAECKASYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDEMSQHWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWLWEEMNSPRAVRDLQVER

Molecular Formula

17174 (Gene_ID) P98064-2 (I455-R733) (Accession)

Molecular Weight

Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YPEL5 (NM_001127399) Human Over-expression Lysate
LC426781 20 µg

YPEL5 (NM_001127399) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Cinnamylglycine
TRC-C442120-1G 1 g

N-Cinnamylglycine

Sign In for Pricing
View Details
Human NOS2/iNOS (Nitric Oxide Synthase 2, Inducible) ELISA Kit
E-EL-H0753-01 24 Tests

Human NOS2/iNOS (Nitric Oxide Synthase 2, Inducible) ELISA Kit

Sign In for Pricing
View Details
Human NOS2/iNOS (Nitric Oxide Synthase 2, Inducible) ELISA Kit
E-EL-H0753-02 48 Tests

Human NOS2/iNOS (Nitric Oxide Synthase 2, Inducible) ELISA Kit

Sign In for Pricing
View Details
Human NOS2/iNOS (Nitric Oxide Synthase 2, Inducible) ELISA Kit
E-EL-H0753-03 96 Tests

Human NOS2/iNOS (Nitric Oxide Synthase 2, Inducible) ELISA Kit

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1870), CF488A conjugate, 0.1mg/mL
BNC881870-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1870), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details