Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NODAL, Human

Nodal protein plays a key role in embryonic development and is indispensable for mesoderm formation and axial patterning. As a homodimer linked together by disulfide bonds, Nodal helps form the molecular framework that controls fundamental developmental pathways, ensuring the correct establishment of mesodermal tissue and axial structure during embryogenesis. NODAL Protein, Human is the recombinant human-derived NODAL protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

NODAL Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

90.0

Smiles

HLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL

Molecular Formula

4838 (Gene_ID) Q96S42 (H238-L347) (Accession)

Molecular Weight

Approximately 14-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mouse Retinal homeobox protein Rx (Rax)
MBS1193856-01 0.02 mg (E-Coli)

Recombinant Mouse Retinal homeobox protein Rx (Rax)

Ask
View Details
Recombinant Mouse Retinal homeobox protein Rx (Rax)
MBS1193856-02 0.02 mg (Yeast)

Recombinant Mouse Retinal homeobox protein Rx (Rax)

Ask
View Details
Recombinant Mouse Retinal homeobox protein Rx (Rax)
MBS1193856-03 0.1 mg (E-Coli)

Recombinant Mouse Retinal homeobox protein Rx (Rax)

Ask
View Details
Recombinant Mouse Retinal homeobox protein Rx (Rax)
MBS1193856-04 0.1 mg (Yeast)

Recombinant Mouse Retinal homeobox protein Rx (Rax)

Ask
View Details
Recombinant Mouse Retinal homeobox protein Rx (Rax)
MBS1193856-05 0.02 mg (Baculovirus)

Recombinant Mouse Retinal homeobox protein Rx (Rax)

Ask
View Details
Recombinant Mouse Retinal homeobox protein Rx (Rax)
MBS1193856-06 0.02 mg (Mammalian-Cell)

Recombinant Mouse Retinal homeobox protein Rx (Rax)

Ask
View Details