Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NODAL, Human

Nodal protein plays a key role in embryonic development and is indispensable for mesoderm formation and axial patterning. As a homodimer linked together by disulfide bonds, Nodal helps form the molecular framework that controls fundamental developmental pathways, ensuring the correct establishment of mesodermal tissue and axial structure during embryogenesis. NODAL Protein, Human is the recombinant human-derived NODAL protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

NODAL Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

90.0

Smiles

HLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL

Molecular Formula

4838 (Gene_ID) Q96S42 (H238-L347) (Accession)

Molecular Weight

Approximately 14-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-10 Polyclonal Antibody, Cy5 Conjugated
bs-23454R-Cy5 100 µL

Caspase-10 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
IFluor® 568 Anti-human CD243 Antibody *UIC2*
124300B1-AAT 500 Tests

IFluor® 568 Anti-human CD243 Antibody *UIC2*

Sign In for Pricing
View Details
Hbb-b2 Mouse Gene Knockout Kit (CRISPR)
KN507593 1 Kit

Hbb-b2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MST1 Antibody
E19-8430-2 100 µg -100 µL

MST1 Antibody

Sign In for Pricing
View Details
MENT Antibody (Biotin)
orb401383-01 50 µg

MENT Antibody (Biotin)

Sign In for Pricing
View Details
MENT Antibody (Biotin)
orb401383-02 100 µg

MENT Antibody (Biotin)

Sign In for Pricing
View Details