Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMN1, Human (His)

SMN1 Protein, Human (His) is the recombinant human-derived SMN1 protein, expressed by E. coli, with N-His tag.

Product Specifications

Product Name Alternative

SMN1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

AMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN

Molecular Formula

6606 (Gene_ID) Q16637-1 (A2-N294) (Accession)

Molecular Weight

Approximately 36-40 kDa & 69 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX21 (NM_013351) Human Recombinant Protein
TP307902 20 µg

TBX21 (NM_013351) Human Recombinant Protein

Sign In for Pricing
View Details
Bulk Anti-Myc Tag (9E10) Antibody
ICH1213-1mg 1 mg

Bulk Anti-Myc Tag (9E10) Antibody

Sign In for Pricing
View Details
PD L2 (PDCD1LG2) Mouse Monoclonal Antibody [Clone ID: OTI1C9]
CF806586 100 µg

PD L2 (PDCD1LG2) Mouse Monoclonal Antibody [Clone ID: OTI1C9]

Sign In for Pricing
View Details
RSPO1 Antibody
KC-7784-01 50 μL

RSPO1 Antibody

Sign In for Pricing
View Details
RSPO1 Antibody
KC-7784-02 100 µL

RSPO1 Antibody

Sign In for Pricing
View Details
RSPO1 Antibody
KC-7784-03 1 mL

RSPO1 Antibody

Sign In for Pricing
View Details