LYPD1, Human (HEK293, His)
LYPD1 Protein, Human (HEK293, His) is the recombinant human-derived LYPD1 protein, expressed by HEK293, with C-His tag.
Product Specifications
Product Name Alternative
LYPD1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Smiles
LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRG
Molecular Formula
116372 (Gene_ID) Q8N2G4-1 (L21-G115) (Accession)
Molecular Weight
Approximately 18-20 kDa & 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
