Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGR4, Human (HEK293, His)

The Lgr4/GPR48 protein is a receptor for R-spondins that activates the canonical Wnt pathway and is critical for organ development (liver, kidney, intestine, bone, reproductive tract, and eye) . Lgr4/GPR48 binds R-spondins (RSPO1-4), binds to phosphorylated LRP6 and Frizzled receptors, and initiates Wnt signaling without activating G proteins. Lgr4/GPR48 Protein, Human (HEK293, His) is the recombinant human-derived Lgr4/GPR48 protein, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

Lgr4/GPR48 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

85

Smiles

APPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLT

Molecular Formula

55366 (Gene_ID) Q9BXB1-1 (A25-T544) (Accession)

Molecular Weight

Approximately 70-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

UHRF1BP1 Antibody
A49618-50UL 50 μL

UHRF1BP1 Antibody

Sign In for Pricing
View Details
Fish Scavenger Receptor Cysteine-Rich Type 1 Protein M130 (CD163) ELISA Kit
MBS9396421 Inquire

Fish Scavenger Receptor Cysteine-Rich Type 1 Protein M130 (CD163) ELISA Kit

Sign In for Pricing
View Details
Human FCRL2/FCRL5 Alexa Fluor 700 Antibody (Clone 296902)
FAB2048N-100UG 100 µg

Human FCRL2/FCRL5 Alexa Fluor 700 Antibody (Clone 296902)

Sign In for Pricing
View Details
DSPP CRISPR Activation Plasmid (h2)
sc-401195-ACT-2 20 µg

DSPP CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Spn Mouse Monoclonal Antibody [Clone ID: WEN3]
TA363851 200 µg

Spn Mouse Monoclonal Antibody [Clone ID: WEN3]

Sign In for Pricing
View Details
Rabbit Anti-AR-α1A/ADRA1A Polyclonal Antibody
PAV5063 100 μL

Rabbit Anti-AR-α1A/ADRA1A Polyclonal Antibody

Sign In for Pricing
View Details