Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF-3, Human (HEK293, Fc)

The PLGF-2 protein is a key growth factor for angiogenesis and endothelial cell growth, crucially stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. It coordinates the angiogenic process, regulates blood vessel growth, and exhibits additional binding capabilities to NRP1/neuropilin-1 and NRP2/neuropilin-2. PLGF-3 Protein, Human (HEK293, Fc) is the recombinant human-derived PLGF-3 protein, expressed by HEK293, with C-Fc labeled tag.

Product Specifications

Product Name Alternative

PLGF-3 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Smiles

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR

Molecular Formula

5228 (Gene_ID) P49763-1 (L19-R221) (Accession)

Molecular Weight

Approximately 60-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREM (cAMP-responsive Element Modulator, Inducible cAMP Early Repressor, ICER) (FITC)
MBS6374712-01 0.1 mL

CREM (cAMP-responsive Element Modulator, Inducible cAMP Early Repressor, ICER) (FITC)

Sign In for Pricing
View Details
CREM (cAMP-responsive Element Modulator, Inducible cAMP Early Repressor, ICER) (FITC)
MBS6374712-02 5x 0.1 mL

CREM (cAMP-responsive Element Modulator, Inducible cAMP Early Repressor, ICER) (FITC)

Sign In for Pricing
View Details
TFDP1 Antibody
A15592-50UG 50 µg

TFDP1 Antibody

Sign In for Pricing
View Details
pX330S-2-PITCh Plasmid
PVT10937 2 µg

pX330S-2-PITCh Plasmid

Sign In for Pricing
View Details
Anti-Human CD309/KDR/VEGFR-2 Antibody (1121B)
HW338107 100 µg

Anti-Human CD309/KDR/VEGFR-2 Antibody (1121B)

Sign In for Pricing
View Details
IL-2 R α/CD25 Protein, Mouse, Recombinant (C-His)
E51P00428 100 µg

IL-2 R α/CD25 Protein, Mouse, Recombinant (C-His)

Sign In for Pricing
View Details