Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF-3, Human (HEK293, Fc)

The PLGF-2 protein is a key growth factor for angiogenesis and endothelial cell growth, crucially stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. It coordinates the angiogenic process, regulates blood vessel growth, and exhibits additional binding capabilities to NRP1/neuropilin-1 and NRP2/neuropilin-2. PLGF-3 Protein, Human (HEK293, Fc) is the recombinant human-derived PLGF-3 protein, expressed by HEK293, with C-Fc labeled tag.

Product Specifications

Product Name Alternative

PLGF-3 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Smiles

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR

Molecular Formula

5228 (Gene_ID) P49763-1 (L19-R221) (Accession)

Molecular Weight

Approximately 60-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-4430 Primers
MPH02648 150 µL - 10 µM

hsa-miR-4430 Primers

Sign In for Pricing
View Details
TRIM56 CytoSection
TS400891P5 25 Slides

TRIM56 CytoSection

Sign In for Pricing
View Details
NCSTNP1 Protein Vector (Human) (pPB-N-His)
PV103923 500 ng

NCSTNP1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
IL2RA Antibody
MBS7103789-01 0.05 mg

IL2RA Antibody

Sign In for Pricing
View Details
IL2RA Antibody
MBS7103789-02 0.1 mg

IL2RA Antibody

Sign In for Pricing
View Details
IL2RA Antibody
MBS7103789-03 5x 0.1 mg

IL2RA Antibody

Sign In for Pricing
View Details