Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMTS14, Human (His)

ADAMTS14 Protein, Human (His) is the recombinant human-derived ADAMTS14 protein, expressed by E. coli, with N-6*His tag.

Product Specifications

Product Name Alternative

ADAMTS14 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

HAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESLGVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLTRQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCADETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYSMDEQCRFDFGSGYQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHCIWKSPEQTYGQDGGW

Molecular Formula

140766 (Gene_ID) Q8WXS8 (H253-W555) (Accession)

Molecular Weight

Approximately 40.2 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human OXT Protein, N-His
YHB92001 100 μg

Recombinant Human OXT Protein, N-His

Ask
View Details
Bovine Serum Albumin Antibody-HRP labled
E51A05653 100 µL

Bovine Serum Albumin Antibody-HRP labled

Ask
View Details
Human MAG knockdown cell line
ABC-KD8875 1 Vial

Human MAG knockdown cell line

Ask
View Details
Human MEI1 Knockout A549 cell line
GTR15410360 1 Vial

Human MEI1 Knockout A549 cell line

Ask
View Details
Mouse Monoclonal GAD1/GAD67 Antibody (GAD1/2391) [Alexa Fluor 700]
NBP3-08276AF700 100 µL

Mouse Monoclonal GAD1/GAD67 Antibody (GAD1/2391) [Alexa Fluor 700]

Ask
View Details
SHMT1 (Serine Hydroxymethyltransferase, Cytosolic, Serine Hydroxymethyltransferase 1 (soluble) )
491684 100 µL

SHMT1 (Serine Hydroxymethyltransferase, Cytosolic, Serine Hydroxymethyltransferase 1 (soluble) )

Ask
View Details