SLC34A2, Human (HEK293, His, mFc)
SLC34A2 Protein, Human (HEK293, His, mFc) is the recombinant human-derived SLC34A2 protein, expressed by HEK293, with N-10*His & C-mFc tag.
Product Specifications
Product Name Alternative
SLC34A2 Protein, Human (HEK293, His, mFc), Human, HEK293
UNSPSC
12352202
Smiles
VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL
Molecular Formula
10568 (Gene_ID) O95436-1 (V234-L362) (Accession)
Molecular Weight
Approximately 66 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-C596145-25G 25 g
2-(2-Chloro-1-iminoethyl)-1,3,5-benzenetriol Hydrochloride
Sign In for Pricing
View Details 
RDR-DUSP1-Hu-01 96 Tests
Human Dual Specificity Phosphatase 1 (DUSP1) ELISA Kit
Sign In for Pricing
View Details