Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP3, Human (HEK293, His)

DPEP3 Protein, Human (HEK293, His) is the recombinant human-derived DPEP3 protein, expressed by HEK293, with C-10*His tag.

Product Specifications

Product Name Alternative

DPEP3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Smiles

AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS

Molecular Formula

64180 (Gene_ID) Q9H4B8 (A36-S463) (Accession)

Molecular Weight

Approximately 48.3 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GGA3 (NM_001172704) Human Over-expression Lysate
LC433320 20 µg

GGA3 (NM_001172704) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR562084 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
NELL1 (NM_001288714) Human Tagged ORF Clone
RG239484 10 µg

NELL1 (NM_001288714) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon: sigmoid
CP556095 150 µg

Tissue Protein Lysate, Colon: sigmoid

Sign In for Pricing
View Details
Automatic Hydrogen Air Generator BGEN-201
BGEN-201 Each

Automatic Hydrogen Air Generator BGEN-201

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS501764 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details