Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP3, Human (HEK293, His)

DPEP3 Protein, Human (HEK293, His) is the recombinant human-derived DPEP3 protein, expressed by HEK293, with C-10*His tag.

Product Specifications

Product Name Alternative

DPEP3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Smiles

AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS

Molecular Formula

64180 (Gene_ID) Q9H4B8 (A36-S463) (Accession)

Molecular Weight

Approximately 48.3 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51B5 Human Gene Knockout Kit (CRISPR)
KN419837 1 Kit

OR51B5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Flt3 / CD135 (FLT3/2458), CF594 conjugate, 0.1mg/mL
BNC942458-100 1x 100 µL

Flt3 / CD135 (FLT3/2458), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Barbital-d5
TRC-B118502-50MG 50 mg

Barbital-d5

Sign In for Pricing
View Details
Hepsin (HPN) (NM_002151) Human Over-expression Lysate
LC400781 20 µg

Hepsin (HPN) (NM_002151) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Tolylhydrazine Monohydrochloride
TRC-T536610-10G 10 g

4-Tolylhydrazine Monohydrochloride

Sign In for Pricing
View Details
Serine Palmitoyltransferase (SPTLC2) (NM_004863) Human Over-expression Lysate
LY401528 100 µg

Serine Palmitoyltransferase (SPTLC2) (NM_004863) Human Over-expression Lysate

Sign In for Pricing
View Details