Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYL12B, Human (His)

MYL12B Protein, Human (His) is the recombinant human-derived MYL12B protein, expressed by E. coli, with C-6*His tag.

Product Specifications

Product Name Alternative

MYL12B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

Molecular Formula

103910 (Gene_ID) O14950 (M1-D172) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NHSL1 (NM_020464) Human Over-expression Lysate
LC431718 20 µg

NHSL1 (NM_020464) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028UE-01 25 µg

APC Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details
APC Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028UE-02 100 µg

APC Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker), CF740 conjugate, 0.1mg/mL
BNC741575-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
19-Norandrosterone (d5 major)
TRC-N661052-1MG 1 mg

19-Norandrosterone (d5 major)

Sign In for Pricing
View Details
4-Pregnen-17alpha,20Beta-diol-3-one
TRC-P712080-25MG 25 mg

4-Pregnen-17alpha,20Beta-diol-3-one

Sign In for Pricing
View Details