MYL9, Human (P. pastoris, His)
MYL9 Protein, Human (P. pastoris, His) is the recombinant human-derived MYL9 protein, expressed by P. pastoris, with C-10*His tag.
Product Specifications
Product Name Alternative
MYL9 Protein, Human (P. pastoris, His), Human, P. pastoris
UNSPSC
12352202
Smiles
SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
Molecular Formula
13098 (Gene_ID) P24844 (S2-D117) (Accession)
Molecular Weight
Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items