Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLC1, Chicken

Product Specifications

Product Name Alternative

MLC1 Protein, Chicken, Others, E. coli

UNSPSC

12352202

Smiles

APKKDVKKPAAAAAPAPAPAPAPAPAPAKPKEPAIDLKSIKIEFSKEQQDDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITFEEFLPMLQAAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVEELMKGQEDSNGCINYEAFVKHIMSV

Molecular Formula

396470 (Gene_ID) P02604 (A2-V192) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASNS Rabbit Polyclonal Antibody (PerCP)
orb2445196 100 µL

ASNS Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Recombinant Xenopus tropicalis Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 (nkain3)
orb2919502-01 20 µg

Recombinant Xenopus tropicalis Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 (nkain3)

Sign In for Pricing
View Details
Recombinant Xenopus tropicalis Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 (nkain3)
orb2919502-02 100 µg

Recombinant Xenopus tropicalis Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 (nkain3)

Sign In for Pricing
View Details
Idarucizumab
T82083-01 1 mg

Idarucizumab

Sign In for Pricing
View Details
Idarucizumab
T82083-02 5 mg

Idarucizumab

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis Yop proteins translocation protein L (yscL)
MBS1044094-01 0.02 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis Yop proteins translocation protein L (yscL)

Sign In for Pricing
View Details