VEGF206, Human (His)
Vascular Endothelial Growth Factor A (VEGF-A) is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF206 Protein, Human (His) is the recombinant human-derived VEGF206 protein, expressed by E. coli, with N-6*His labeled tag.
Product Specifications
Product Name Alternative
VEGF206 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Smiles
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular Formula
7422 (Gene_ID) P15692-1 (A27-R232) (Accession)
Molecular Weight
Approximately 30.8 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP304819L 1 mg
RPB11 (POLR2J) (NM_006234) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC883284-100 1x 100 µL
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3284), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP12211PU-N 400 µL
GPIP137 (CAPRIN1) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 