IgG2 Fc, Human (HEK293)
The IgG2 Fc protein is the constant region of the immunoglobulin heavy chain and acts as an antigen receptor, triggering the expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG2 Fc Protein, Human (HEK293) is the recombinant human-derived IgG2 Fc protein, expressed by HEK293, with tag free.
Product Specifications
Product Name Alternative
IgG2 Fc Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Smiles
ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Formula
/ (Gene_ID) P01859-1 (E99-L326) (Accession)
Molecular Weight
Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal Nuclear Antigen Antibody (rNM106) [FITC]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP3-14097F 0.1 mL
Mouse Monoclonal Nuclear Antigen Antibody (rNM106) [FITC]
Sign In for Pricing
View Details 
494169 100 µL
TMPO (Lamina-Associated Polypeptide 2, Isoform Alpha, Thymopoietin)
Sign In for Pricing
View Details MBS1278823-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock
CDYL2 cDNA Clone
Sign In for Pricing
View Details MBS1278823-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock
CDYL2 cDNA Clone
Sign In for Pricing
View Details