IgG2 Fc, Human (HEK293)
The IgG2 Fc protein is the constant region of the immunoglobulin heavy chain and acts as an antigen receptor, triggering the expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG2 Fc Protein, Human (HEK293) is the recombinant human-derived IgG2 Fc protein, expressed by HEK293, with tag free.
Product Specifications
Product Name Alternative
IgG2 Fc Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Smiles
ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Formula
/ (Gene_ID) P01859-1 (E99-L326) (Accession)
Molecular Weight
Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15383684 1 Vial
Lentiviral human ADRA2A sgRNA gene knockout kit - Lentiviral human ADRA2A sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 
