UBE2V2, Human (sf9, His, strep)
UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (sf9, His, strep) is the recombinant human-derived UBE2V2 protein, expressed by Sf9 insect cells, with N-His and N-Strep labeled tag.
Product Specifications
Product Name Alternative
UBE2V2 Protein, Human (sf9, His, strep), Human, Sf9 insect cells
UNSPSC
12352202
Smiles
MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
Molecular Formula
7336 (Gene_ID) Q15819 (M1-N145) (Accession)
Molecular Weight
Approximately 16.4 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog