Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2V2, Human (sf9, His, strep)

UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (sf9, His, strep) is the recombinant human-derived UBE2V2 protein, expressed by Sf9 insect cells, with N-His and N-Strep labeled tag.

Product Specifications

Product Name Alternative

UBE2V2 Protein, Human (sf9, His, strep), Human, Sf9 insect cells

UNSPSC

12352202

Smiles

MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

Molecular Formula

7336 (Gene_ID) Q15819 (M1-N145) (Accession)

Molecular Weight

Approximately 16.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1L1 Antibody
KC-29653-01 50 μL

ALDH1L1 Antibody

Sign In for Pricing
View Details
ALDH1L1 Antibody
KC-29653-02 100 µL

ALDH1L1 Antibody

Sign In for Pricing
View Details
ALDH1L1 Antibody
KC-29653-03 1 mL

ALDH1L1 Antibody

Sign In for Pricing
View Details
Oct6 (POU3F1) Rabbit Polyclonal Antibody
AP20431PU-N 100 µg

Oct6 (POU3F1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl2 Binding component 3 (BBC3) (NM_001127240) Human Recombinant Protein
TP325345M 100 µg

Bcl2 Binding component 3 (BBC3) (NM_001127240) Human Recombinant Protein

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997I-01 50 Tests

PE/Cyanine5.5 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details