Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2N/Ubc13, Human (sf9)

Product Specifications

Product Name Alternative

UBE2N/Ubc13 Protein, Human (sf9), Human, Sf9 insect cells

UNSPSC

12352202

Smiles

AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI

Molecular Formula

7334 (Gene_ID) P61088 (A2-I152) (Accession)

Molecular Weight

Approximately 16.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene AM HMBA
H10014.5G 5 g

Polystyrene AM HMBA

Sign In for Pricing
View Details
Rabbit Monoclonal TGF-alpha Antibody (tAb2) [Alexa Fluor 594]
NBP2-81082AF594 0.1 mL

Rabbit Monoclonal TGF-alpha Antibody (tAb2) [Alexa Fluor 594]

Sign In for Pricing
View Details
FAM166A CRISPR Knock Out 293T Cell Line (Human)
19824141 1x 10^6 Cells / 1.0 mL

FAM166A CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Rat Cyclic guanosine monophosphate,cGMP ELISA KIT
JOT-EK0297Ra-01 96 Well

Rat Cyclic guanosine monophosphate,cGMP ELISA KIT

Sign In for Pricing
View Details
Rat Cyclic guanosine monophosphate,cGMP ELISA KIT
JOT-EK0297Ra-02 48 Well

Rat Cyclic guanosine monophosphate,cGMP ELISA KIT

Sign In for Pricing
View Details
Biotinylated Recombinant Human Notch 1 Protein, Avi His Tag
KMP2059 100 µg

Biotinylated Recombinant Human Notch 1 Protein, Avi His Tag

Sign In for Pricing
View Details