Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2N/Ubc13, Human (sf9)

Product Specifications

Product Name Alternative

UBE2N/Ubc13 Protein, Human (sf9), Human, Sf9 insect cells

UNSPSC

12352202

Smiles

AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI

Molecular Formula

7334 (Gene_ID) P61088 (A2-I152) (Accession)

Molecular Weight

Approximately 16.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Myostatin (MSTN) ELISA Kit DIY Materials
MBS2089127-01 5x 96 Tests

Rat Myostatin (MSTN) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Rat Myostatin (MSTN) ELISA Kit DIY Materials
MBS2089127-02 5x 96 Tests + MBS2089472 (Support Pack 2,5x 96 Tests)

Rat Myostatin (MSTN) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Rat Myostatin (MSTN) ELISA Kit DIY Materials
MBS2089127-03 10x 96 Tests

Rat Myostatin (MSTN) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Rat Myostatin (MSTN) ELISA Kit DIY Materials
MBS2089127-04 10x 96 Tests + MBS2089472 (Support Pack 2, 10x 96 Tests)

Rat Myostatin (MSTN) ELISA Kit DIY Materials

Sign In for Pricing
View Details
MKRN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
TA504092S 30 µL

MKRN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)

Sign In for Pricing
View Details
Rat IgG1-BIOT
MBS679079-01 0.5 mg

Rat IgG1-BIOT

Sign In for Pricing
View Details