CHMP1B, Human (GST)
CHMP1B Protein, Human (GST) is the recombinant human-derived CHMP1B protein, expressed by E. coli, with N-GST tag.
Product Specifications
Product Name Alternative
CHMP1B Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Smiles
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV
Molecular Formula
57132 (Gene_ID) Q7LBR1 (M1-V199) (Accession)
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7054660 Inquire
Recombinant Human Dolichol kinase (DOLK), partial
Sign In for Pricing
View Details 
AN301011L-01 50 µL
Recombinant Phospho-FOXO3A (Ser253) Monoclonal Antibody
Sign In for Pricing
View Details AN301011L-02 100 µL
Recombinant Phospho-FOXO3A (Ser253) Monoclonal Antibody
Sign In for Pricing
View Details