Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Integrin alpha V, Human (P. pastoris, His)

Product Specifications

Product Name Alternative

Integrin alpha V Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Purity

98.0

Smiles

DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET

Molecular Formula

3685 (Gene_ID) P06756 (D891-T1048) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Anti Human KCNK18 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8424107-01 0.12 mL

Rabbit Anti Human KCNK18 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)

Ask
View Details
Rabbit Anti Human KCNK18 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8424107-02 0.2 mL

Rabbit Anti Human KCNK18 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)

Ask
View Details
Rabbit Anti Human KCNK18 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8424107-03 5x 0.2 mL

Rabbit Anti Human KCNK18 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)

Ask
View Details
Rat Inosine triphosphate pyrophosphatase ELISA Kit
MBS2887508-01 48 Well

Rat Inosine triphosphate pyrophosphatase ELISA Kit

Ask
View Details
Rat Inosine triphosphate pyrophosphatase ELISA Kit
MBS2887508-02 96 Well

Rat Inosine triphosphate pyrophosphatase ELISA Kit

Ask
View Details
Rat Inosine triphosphate pyrophosphatase ELISA Kit
MBS2887508-03 5x 96 Well

Rat Inosine triphosphate pyrophosphatase ELISA Kit

Ask
View Details