Vpr, HIV-1 group M subtype G
Vpr Protein, HIV-1 group M subtype G (GST) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-GST tag.
Product Specifications
Product Name Alternative
Vpr Protein, HIV-1 group M subtype G (GST), Virus, E. coli
UNSPSC
12352202
Smiles
MEQAPEDQGPQREPYNEWALELLEELKNEAVRHFPRLWLHGLGQHIYNTYGDTWEGVEAIIRILQQLLFIHFRIGCQHSRIGITPRRRVRDGPGRS
Molecular Formula
/ (Gene_ID) O89942 (M1-S96) (Accession)
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2382603 1.0 µg DNA
TM9SF4 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 21761003-3 5 mg
Artocarpus integrifolia Lectin (AIA) - FITC (Fluorescein)
Sign In for Pricing
View Details