Vpr, HIV-1 group M subtype G
Vpr Protein, HIV-1 group M subtype G (GST) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-GST tag.
Product Specifications
Product Name Alternative
Vpr Protein, HIV-1 group M subtype G (GST), Virus, E. coli
UNSPSC
12352202
Smiles
MEQAPEDQGPQREPYNEWALELLEELKNEAVRHFPRLWLHGLGQHIYNTYGDTWEGVEAIIRILQQLLFIHFRIGCQHSRIGITPRRRVRDGPGRS
Molecular Formula
/ (Gene_ID) O89942 (M1-S96) (Accession)
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![MAD2L2 Rabbit Monoclonal Antibody [Clone ID: 24GB4950]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
