Vpr, HIV-1 group M subtype G
Vpr Protein, HIV-1 group M subtype G (GST) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-GST tag.
Product Specifications
Product Name Alternative
Vpr Protein, HIV-1 group M subtype G (GST), Virus, E. coli
UNSPSC
12352202
Smiles
MEQAPEDQGPQREPYNEWALELLEELKNEAVRHFPRLWLHGLGQHIYNTYGDTWEGVEAIIRILQQLLFIHFRIGCQHSRIGITPRRRVRDGPGRS
Molecular Formula
/ (Gene_ID) O89942 (M1-S96) (Accession)
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15396136 1 Vial
Lentiviral human DNAJA3 sgRNA gene knockout kit - Lentiviral human DNAJA3 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 
CSNK2A2-2023M 50 µg
Recombinant Mouse CSNK2A2 Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details MBS8107903-01 0.1 mL
Anti-JAM-A/Junctional Adhesion Molecule A Antibody, Rabbit Polyclonal
Sign In for Pricing
View Details