Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vpr Protein, HIV-1 group M subtype C (His, Myc)

Vpr Protein, HIV-1 group M subtype C (His, Myc) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-10*His & C-Myc tag.

Product Specifications

Product Name Alternative

Vpr Protein, HIV-1 group M subtype C (His, Myc), Virus, E. coli

UNSPSC

12352202

Smiles

MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHGLGQHIYETYGDTWTGVEAIIRILQRLLFVHFRIGCQHSRIGILRQRRARNGASRS

Molecular Formula

(Gene_ID) O12160 (M1-S96) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)
MBS1118899-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)

Ask
View Details
Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)
MBS1118899-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)

Ask
View Details
Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)
MBS1118899-03 0.02 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)

Ask
View Details
Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)
MBS1118899-04 0.1 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)

Ask
View Details
Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)
MBS1118899-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)

Ask
View Details
Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)
MBS1118899-06 1 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Thiosulfate sulfurtransferase glpE (glpE)

Ask
View Details