Vpr, HIV-1 group M subtype K (His, Myc)
Vpr Protein, HIV-1 group M subtype K (His, Myc) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-10*His & C-Myc tag.
Product Specifications
Product Name Alternative
Vpr Protein, HIV-1 group M subtype K (His, Myc), Virus, E. coli
UNSPSC
12352202
Smiles
MEQAPEDQGPQREPNNEWTLEILEELKREAVRHFPRPWLHNLGQHIYTTYGDTWEGLEAIIRILQQLLFIHFRIGCHHSRIGIIPQRRGRNGSSRS
Molecular Formula
(Gene_ID) P0C1P2 (M1-S96) (Accession)
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
R2031-59B-PE 200 µL
RICK, CT (Receptor-interacting Serine/Threonine Protein Kinase 2, RIP-like Interacting CLARP Kinase, Receptor-interacting Protein 2, RIP-2, CARD-containing Interleukin-1 beta Converting Enzyme Associated Kinase, CARD-containing IL-1 beta ICE-kinase, RIPK2, CARDIAK, RIP2, UNQ277/PRO314/PRO34092) (PE) discontinued
Ask
View Details 