Vpr, HIV-1 group M subtype K (His, Myc)
Vpr Protein, HIV-1 group M subtype K (His, Myc) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-10*His & C-Myc tag.
Product Specifications
Product Name Alternative
Vpr Protein, HIV-1 group M subtype K (His, Myc), Virus, E. coli
UNSPSC
12352202
Smiles
MEQAPEDQGPQREPNNEWTLEILEELKREAVRHFPRPWLHNLGQHIYTTYGDTWEGLEAIIRILQQLLFIHFRIGCHHSRIGIIPQRRGRNGSSRS
Molecular Formula
(Gene_ID) P0C1P2 (M1-S96) (Accession)
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items