Dectin-1/CLEC7A Protein, Human (HEK293, hFc)
The Dectin-1/CLEC7A protein is a lectin and pattern recognition receptor that targets β-1,3- and β-1,6-linked glucans in bacterial and fungal cell walls. It triggers Toll-like receptor 2 (TLR2) -mediated inflammation by recruiting splenic tyrosine kinase (SYK) and activating the CARD domain-BCL10-MALT1 (CBM) signalosome. Dectin-1/CLEC7A Protein, Human (HEK293, hFc) is the recombinant human-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with hFc tag.
Product Specifications
Product Name Alternative
Dectin-1/CLEC7A Protein, Human (HEK293, hFc), Human, HEK293
UNSPSC
12352202
Smiles
TMGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
Molecular Formula
64581 (Gene_ID) Q9BXN2-2/NP_072092.2 (T66-M201) (Accession)
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items