Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dectin-1/CLEC7A Protein, Human (HEK293, hFc)

The Dectin-1/CLEC7A protein is a lectin and pattern recognition receptor that targets β-1,3- and β-1,6-linked glucans in bacterial and fungal cell walls. It triggers Toll-like receptor 2 (TLR2) -mediated inflammation by recruiting splenic tyrosine kinase (SYK) and activating the CARD domain-BCL10-MALT1 (CBM) signalosome. Dectin-1/CLEC7A Protein, Human (HEK293, hFc) is the recombinant human-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with hFc tag.

Product Specifications

Product Name Alternative

Dectin-1/CLEC7A Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Smiles

TMGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM

Molecular Formula

64581 (Gene_ID) Q9BXN2-2/NP_072092.2 (T66-M201) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti MerA Mab [10A9]
401012 100 µg

Anti MerA Mab [10A9]

Ask
View Details
Pttg1ip (NM_145925) Mouse Tagged ORF Clone
MG201502 10 µg

Pttg1ip (NM_145925) Mouse Tagged ORF Clone

Ask
View Details
Glucagon, NT (GCG, Glicentin-related Polypeptide, GRPP) (MaxLight 650)
MBS6477936-01 0.1 mL

Glucagon, NT (GCG, Glicentin-related Polypeptide, GRPP) (MaxLight 650)

Ask
View Details
Glucagon, NT (GCG, Glicentin-related Polypeptide, GRPP) (MaxLight 650)
MBS6477936-02 5x 0.1 mL

Glucagon, NT (GCG, Glicentin-related Polypeptide, GRPP) (MaxLight 650)

Ask
View Details
Recombinant Anti-PD-L1 antibody (Rabbit mAb)
GB155736-100 100 μL

Recombinant Anti-PD-L1 antibody (Rabbit mAb)

Ask
View Details
DDX17 (B-6)
sc-376297 200 µg/mL

DDX17 (B-6)

Ask
View Details