Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA7, Human (His)

CHRNA7 Protein, Human (His) is the recombinant human-derived CHRNA7 protein, expressed by E. coli, with N-6*His tag.

Product Specifications

Product Name Alternative

CHRNA7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Purity

90.00

Smiles

GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRT

Molecular Formula

1139/89832 (Gene_ID) P36544-1 (G23-T230) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Secretogranin-1/CHGB protein (His tag)
PDMH100379-01 20 µg

Recombinant Human Secretogranin-1/CHGB protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Secretogranin-1/CHGB protein (His tag)
PDMH100379-02 100 µg

Recombinant Human Secretogranin-1/CHGB protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Secretogranin-1/CHGB protein (His tag)
PDMH100379-03 500 µg

Recombinant Human Secretogranin-1/CHGB protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Secretogranin-1/CHGB protein (His tag)
PDMH100379-04 1 mg

Recombinant Human Secretogranin-1/CHGB protein (His tag)

Sign In for Pricing
View Details
Mouse Glypican 1 (GPC1) ELISA Kit
MBS287164-01 48 Tests

Mouse Glypican 1 (GPC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Glypican 1 (GPC1) ELISA Kit
MBS287164-02 96 Tests

Mouse Glypican 1 (GPC1) ELISA Kit

Sign In for Pricing
View Details