Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1, Human (HEK293, His)

ECM1 Protein, Human (HEK293, His) is the recombinant human-derived ECM1 protein, expressed by HEK293, with C-His tag.

Product Specifications

Product Name Alternative

ECM1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

97.40

Smiles

MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE

Molecular Formula

1893 (Gene_ID) Q16610-1 (M1-E540) (Accession)

Molecular Weight

Predicted band size: 60.2 kDa; Observed band size: 80-90 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Lung
CP565737 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF647 conjugate, 0.1mg/mL
BNC470807-100 1x 100 µL

TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD51 (ITGAV) (NM_001144999) Human Over-expression Lysate
LC428633 20 µg

CD51 (ITGAV) (NM_001144999) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS805043 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
1-Chloro-4-iodobutane
TRC-C585562-25G 25 g

1-Chloro-4-iodobutane

Sign In for Pricing
View Details
3-Cyano-4-(3-chloro-4-fluoroanilino)-7-ethoxy-6-(phthalimidyl)quinoline
TRC-C962400-25MG 25 mg

3-Cyano-4-(3-chloro-4-fluoroanilino)-7-ethoxy-6-(phthalimidyl)quinoline

Sign In for Pricing
View Details