Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1, Human (HEK293, His)

ECM1 Protein, Human (HEK293, His) is the recombinant human-derived ECM1 protein, expressed by HEK293, with C-His tag.

Product Specifications

Product Name Alternative

ECM1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

97.40

Smiles

MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE

Molecular Formula

1893 (Gene_ID) Q16610-1 (M1-E540) (Accession)

Molecular Weight

Predicted band size: 60.2 kDa; Observed band size: 80-90 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary
CR561549 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
Human C20orf111 (OSER1) activation kit by CRISPRa
GA109852 1 Kit

Human C20orf111 (OSER1) activation kit by CRISPRa

Sign In for Pricing
View Details
Human Nectin-2 Recombinant Rabbit monoclonal Antibody
HA723461 100 µL

Human Nectin-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD6 (C6/372 + 3F7B5), CF640R conjugate, 0.1mg/mL
BNC401228-100 1x 100 µL

CD6 (C6/372 + 3F7B5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ROPN1B (NM_001012337) Human Over-expression Lysate
LY423329 100 µg

ROPN1B (NM_001012337) Human Over-expression Lysate

Sign In for Pricing
View Details
LDHA Mouse Monoclonal Antibody [20-179]
M1007-7 100 µL

LDHA Mouse Monoclonal Antibody [20-179]

Sign In for Pricing
View Details