Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1, Human (HEK293, His)

ECM1 Protein, Human (HEK293, His) is the recombinant human-derived ECM1 protein, expressed by HEK293, with C-His tag.

Product Specifications

Product Name Alternative

ECM1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

97.40

Smiles

MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE

Molecular Formula

1893 (Gene_ID) Q16610-1 (M1-E540) (Accession)

Molecular Weight

Predicted band size: 60.2 kDa; Observed band size: 80-90 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TBX22 activation kit by CRISPRa
GA109482 1 Kit

Human TBX22 activation kit by CRISPRa

Sign In for Pricing
View Details
Dieldrin
TRC-D441780-50MG 50 mg

Dieldrin

Sign In for Pricing
View Details
Eph receptor B2 (EPHB2) Human Gene Knockout Kit (CRISPR)
KN423219 1 Kit

Eph receptor B2 (EPHB2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Syndecan 4 Recombinant Rabbit Monoclonal Antibody [PSH0-72]
HA721473 100 µL

Syndecan 4 Recombinant Rabbit Monoclonal Antibody [PSH0-72]

Sign In for Pricing
View Details
NUDT2 (NM_001161) Human Over-expression Lysate
LY420095 100 µg

NUDT2 (NM_001161) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Uromucoid (UMOD) ELISA KIT (1 x 96 wells)
EA102492 96 Well

Human Uromucoid (UMOD) ELISA KIT (1 x 96 wells)

Sign In for Pricing
View Details