Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GZMA/Granzyme A, Mouse (His)

GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Mouse (His) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GZMA/Granzyme A Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Smiles

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Molecular Formula

14938 (Gene_ID) P11032 (I29-V260) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1R,3S)-3-Aminocyclopentanol Hydrochloride
TRC-A596540-25MG 25 mg

(1R,3S)-3-Aminocyclopentanol Hydrochloride

Sign In for Pricing
View Details
Lamin B1 (LMNB1) (C-term) Rabbit Polyclonal Antibody
AP23277PU-N 100 µg

Lamin B1 (LMNB1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995US-01 25 µg

Elab Fluor® Red 780 Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995US-02 100 µg

Elab Fluor® Red 780 Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
NRG3 (NM_001165973) Human Over-expression Lysate
LY431442 100 µg

NRG3 (NM_001165973) Human Over-expression Lysate

Sign In for Pricing
View Details
COL23A1 (NM_173465) Human Recombinant Protein
TP320535M 100 µg

COL23A1 (NM_173465) Human Recombinant Protein

Sign In for Pricing
View Details