Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GZMA/Granzyme A, Mouse (His)

GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Mouse (His) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GZMA/Granzyme A Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Smiles

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Molecular Formula

14938 (Gene_ID) P11032 (I29-V260) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Livin (BIRC7) (NM_139317) Human Over-expression Lysate
LC403386 20 µg

Livin (BIRC7) (NM_139317) Human Over-expression Lysate

Sign In for Pricing
View Details
Cesium Iodide
TRC-C280018-500MG 500 mg

Cesium Iodide

Sign In for Pricing
View Details
ACTN3 Polyclonal Antibody
E-AB-90515-01 60 µL

ACTN3 Polyclonal Antibody

Sign In for Pricing
View Details
ACTN3 Polyclonal Antibody
E-AB-90515-02 120 µL

ACTN3 Polyclonal Antibody

Sign In for Pricing
View Details
ACTN3 Polyclonal Antibody
E-AB-90515-03 200 µL

ACTN3 Polyclonal Antibody

Sign In for Pricing
View Details
Weighing Scale BBAL-403
BBAL-403 1 Unit

Weighing Scale BBAL-403

Sign In for Pricing
View Details