Latent GDF-8, Human (HEK293, His)
GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. Latent GDF-8 Protein, Human (HEK293, His) is the recombinant human-derived Latent GDF-8 protein, expressed by HEK293, with N-His labeled tag.
Product Specifications
Product Name Alternative
Latent GDF-8 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Purity
95.0
Smiles
NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Molecular Formula
2660 (Gene_ID) O14793 (N24-S375) (Accession)
Molecular Weight
Approximately 35-40 kDa & 45-55 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880008-100 1x 100 µL
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details