GDF-8, Human/Mouse/Rat (109a.a, HEK293, Avi, Solution)
GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (Biotinylated, 109a.a, HEK293, Avi, Solution) is the recombinant rat/mouse/human-derived GDF-8 protein, expressed by HEK293, with C-Avi labeled tag.
Product Specifications
Product Name Alternative
GDF-8 Protein, Human/Mouse/Rat (Biotinylated, 109a.a, HEK293, Avi, Solution), Rat; Human; Mouse, HEK293
UNSPSC
12352202
Purity
95.00
Smiles
DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Molecular Formula
2660 (Gene_ID) O14793 (D267-S375) (Accession)
Molecular Weight
Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
CD59 (heavy chain of Protectin) (MACIF/629), CF594 conjugate, 0.1mg/mL
