Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STEAP1, Mouse (Cell-Free, His)

The STEAP1 protein is classified as a member of the metal reductase family and cannot function as a functional metal reductase, mainly due to the lack of binding sites for the electron-donating substrate NADPH. This unique feature distinguishes STEAP1 from typical metal reductases, which are characterized by their ability to catalyze the reduction of metal ions using NADPH as an electron donor. STEAP1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived STEAP1 protein, expressed by E. coli Cell-free , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

STEAP1 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Smiles

MEISDDVTNPEQLWKMKPKGNLEDDSYSTKDSGETSMLKRPGLSHLQHAVHVDAFDCPSELQHTQEFFPNWRLPVKVAAIISSLTFLYTLLREIIYPLVTSREQYFYKIPILVINKVLPMVAITLLALVYLPGELAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAVYSLSYPMRRSYRYKLLNWAYKQVQQNKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTVHALVFAWNKWVDVSQFVWYMPPTFMIAVFLPTLVLICKIALCLPCLRKKILKIRCGWEDVSKINRTEMASRL

Molecular Formula

70358 (Gene_ID) Q9CWR7 (M1-L339) (Accession)

Molecular Weight

40.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TLS/FUS Rabbit Monoclonal Antibody
M00771-2-200μl 200 µL

Anti-TLS/FUS Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
KLHDC1 Protein Vector (Mouse) (pPM-C-HA)
PV194556 500 ng

KLHDC1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
GSN Protein Vector (Mouse) (pPB-N-His)
PV186951 500 ng

GSN Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human NMNAT2 (Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2) ELISA Kit
MBS7616715-01 48 Well

Human NMNAT2 (Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2) ELISA Kit

Sign In for Pricing
View Details
Human NMNAT2 (Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2) ELISA Kit
MBS7616715-02 96 Well

Human NMNAT2 (Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2) ELISA Kit

Sign In for Pricing
View Details
Human NMNAT2 (Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2) ELISA Kit
MBS7616715-03 5x 96 Well

Human NMNAT2 (Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2) ELISA Kit

Sign In for Pricing
View Details