Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STEAP1, Mouse (Cell-Free, His)

The STEAP1 protein is classified as a member of the metal reductase family and cannot function as a functional metal reductase, mainly due to the lack of binding sites for the electron-donating substrate NADPH. This unique feature distinguishes STEAP1 from typical metal reductases, which are characterized by their ability to catalyze the reduction of metal ions using NADPH as an electron donor. STEAP1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived STEAP1 protein, expressed by E. coli Cell-free , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

STEAP1 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Smiles

MEISDDVTNPEQLWKMKPKGNLEDDSYSTKDSGETSMLKRPGLSHLQHAVHVDAFDCPSELQHTQEFFPNWRLPVKVAAIISSLTFLYTLLREIIYPLVTSREQYFYKIPILVINKVLPMVAITLLALVYLPGELAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAVYSLSYPMRRSYRYKLLNWAYKQVQQNKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTVHALVFAWNKWVDVSQFVWYMPPTFMIAVFLPTLVLICKIALCLPCLRKKILKIRCGWEDVSKINRTEMASRL

Molecular Formula

70358 (Gene_ID) Q9CWR7 (M1-L339) (Accession)

Molecular Weight

40.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX6-3, ID (NKX6-3, Homeobox protein Nkx-6.3) (Azide free) (HRP)
MBS6325679-01 0.2 mL

NKX6-3, ID (NKX6-3, Homeobox protein Nkx-6.3) (Azide free) (HRP)

Sign In for Pricing
View Details
NKX6-3, ID (NKX6-3, Homeobox protein Nkx-6.3) (Azide free) (HRP)
MBS6325679-02 5x 0.2 mL

NKX6-3, ID (NKX6-3, Homeobox protein Nkx-6.3) (Azide free) (HRP)

Sign In for Pricing
View Details
PON1 Polyclonal Antibody
RA28929-01 50 µL

PON1 Polyclonal Antibody

Sign In for Pricing
View Details
PON1 Polyclonal Antibody
RA28929-02 100 µL

PON1 Polyclonal Antibody

Sign In for Pricing
View Details
6,7,7-Trimethyl-1H,2H,3H,4H,5H,6H,7H-pyrrolo[3,4-d]pyrimidine-2,4-dione
JDB60077-01 50 mg

6,7,7-Trimethyl-1H,2H,3H,4H,5H,6H,7H-pyrrolo[3,4-d]pyrimidine-2,4-dione

Sign In for Pricing
View Details
6,7,7-Trimethyl-1H,2H,3H,4H,5H,6H,7H-pyrrolo[3,4-d]pyrimidine-2,4-dione
JDB60077-02 0.5 g

6,7,7-Trimethyl-1H,2H,3H,4H,5H,6H,7H-pyrrolo[3,4-d]pyrimidine-2,4-dione

Sign In for Pricing
View Details