Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A19, Human (Cell-Free, His)

SLC25A19, a pivotal mitochondrial transporter, facilitates thiamine diphosphate uptake into mitochondria. While the specifics of its antiporter activity regarding the influence of membrane potential or proton electrochemical gradient remain unclear, SLC25A19's role as a transporter underscores its importance in mitochondrial processes, particularly the transport of thiamine diphosphate, a vital coenzyme in various metabolic pathways. SLC25A19 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC25A19 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

SLC25A19 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Smiles

MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR

Molecular Formula

60386 (Gene_ID) Q9HC21 (M1-R320) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal PIGC antibody - C-terminal region
AMM07170G 0.05mg

Polyclonal PIGC antibody - C-terminal region

Sign In for Pricing
View Details
TRAT1, ID (TRAT1, TCRIM, T-cell receptor-associated transmembrane adapter 1, T-cell receptor-interacting molecule, pp29/30) (MaxLight 650)
MBS6358008-01 0.1 mL

TRAT1, ID (TRAT1, TCRIM, T-cell receptor-associated transmembrane adapter 1, T-cell receptor-interacting molecule, pp29/30) (MaxLight 650)

Sign In for Pricing
View Details
TRAT1, ID (TRAT1, TCRIM, T-cell receptor-associated transmembrane adapter 1, T-cell receptor-interacting molecule, pp29/30) (MaxLight 650)
MBS6358008-02 5x 0.1 mL

TRAT1, ID (TRAT1, TCRIM, T-cell receptor-associated transmembrane adapter 1, T-cell receptor-interacting molecule, pp29/30) (MaxLight 650)

Sign In for Pricing
View Details
ARHGEF4 AAV Vector (Human) (CMV)
12341101 1 µg

ARHGEF4 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human Non Metastatic Cells 3, Protein NM23A Expressed In (NME3) ELISA Kit
MBS2710365-01 24 Strip Well

Human Non Metastatic Cells 3, Protein NM23A Expressed In (NME3) ELISA Kit

Sign In for Pricing
View Details
Human Non Metastatic Cells 3, Protein NM23A Expressed In (NME3) ELISA Kit
MBS2710365-02 48 Well

Human Non Metastatic Cells 3, Protein NM23A Expressed In (NME3) ELISA Kit

Sign In for Pricing
View Details