Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A19, Human (Cell-Free, His)

SLC25A19, a pivotal mitochondrial transporter, facilitates thiamine diphosphate uptake into mitochondria. While the specifics of its antiporter activity regarding the influence of membrane potential or proton electrochemical gradient remain unclear, SLC25A19's role as a transporter underscores its importance in mitochondrial processes, particularly the transport of thiamine diphosphate, a vital coenzyme in various metabolic pathways. SLC25A19 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC25A19 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

SLC25A19 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Smiles

MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR

Molecular Formula

60386 (Gene_ID) Q9HC21 (M1-R320) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2,2-Trifluoroethyl Formate
TRC-T774535-10G 10 g

2,2,2-Trifluoroethyl Formate

Sign In for Pricing
View Details
Trdn sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
47694114 3x 1.0 µg

Trdn sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human IL-17F Protein, His Tag, low endotoxin (MALS verified)
ILF-H5244-20ug 20 µg

Human IL-17F Protein, His Tag, low endotoxin (MALS verified)

Sign In for Pricing
View Details
pDNR-LIB-Dpm3 Plasmid
PVT43374 2 µg

pDNR-LIB-Dpm3 Plasmid

Sign In for Pricing
View Details
LONRF3 (LON Peptidase N-terminal Domain and RING Finger Protein 3, RING Finger Protein 127, RNF127) (MaxLight 405)
MBS6192322-01 0.1 mL

LONRF3 (LON Peptidase N-terminal Domain and RING Finger Protein 3, RING Finger Protein 127, RNF127) (MaxLight 405)

Sign In for Pricing
View Details
LONRF3 (LON Peptidase N-terminal Domain and RING Finger Protein 3, RING Finger Protein 127, RNF127) (MaxLight 405)
MBS6192322-02 5x 0.1 mL

LONRF3 (LON Peptidase N-terminal Domain and RING Finger Protein 3, RING Finger Protein 127, RNF127) (MaxLight 405)

Sign In for Pricing
View Details