Matrix protein 2, Influenza A virus 1935 H1N1 (Cell-Free, His)
Matrix protein 2 (M2) forms a proton-selective ion channel that is critical for the release of the viral genome during viral entry. Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His) is the recombinant Virus-derived Matrix protein 2 protein, expressed by E. coli Cell-free , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His), Virus, E. coli Cell-free
UNSPSC
12352202
Smiles
MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE
Molecular Formula
/ (Gene_ID) A4GCM0 (M1-E97) (Accession)
Molecular Weight
15.1 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog