Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Matrix protein 2, Influenza A virus 1935 H1N1 (Cell-Free, His)

Matrix protein 2 (M2) forms a proton-selective ion channel that is critical for the release of the viral genome during viral entry. Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His) is the recombinant Virus-derived Matrix protein 2 protein, expressed by E. coli Cell-free , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His), Virus, E. coli Cell-free

UNSPSC

12352202

Smiles

MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE

Molecular Formula

/ (Gene_ID) A4GCM0 (M1-E97) (Accession)

Molecular Weight

15.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog