Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Matrix protein 2, Influenza A virus 1935 H1N1 (Cell-Free, His)

Matrix protein 2 (M2) forms a proton-selective ion channel that is critical for the release of the viral genome during viral entry. Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His) is the recombinant Virus-derived Matrix protein 2 protein, expressed by E. coli Cell-free , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His), Virus, E. coli Cell-free

UNSPSC

12352202

Smiles

MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE

Molecular Formula

/ (Gene_ID) A4GCM0 (M1-E97) (Accession)

Molecular Weight

15.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-100 1x 100 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-500 1x 500 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-500 1x 500 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-100 1x 100 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details